Galectin 1 (LGALS1) (NM_002305) Human Mass Spec Standard
CAT#: PH304674
LGALS1 MS Standard C13 and N15-labeled recombinant protein (NP_002296)
View other "Galectin 1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | LGALS1 MS Standard C13 and N15-labeled recombinant protein (NP_002296) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204674 |
| Predicted MW | 14.7 kDa |
| Protein Sequence |
>RC204674 protein sequence
Red=Cloning site Green=Tags(s) MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002296 |
| RefSeq Size | 586 |
| RefSeq ORF | 405 |
| Synonyms | GAL1; GBP |
| Locus ID | 3956 |
| Cytogenetics | 22q13.1 |
| Summary | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400833 | LGALS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400833 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 1 (LGALS1) |
CNY 3080.00 |
|
| TP304674 | Recombinant protein of human lectin, galactoside-binding, soluble, 1 (LGALS1), 20 µg |
CNY 2900.00 |
|
| TP720620 | Purified recombinant protein of Human lectin, galactoside-binding, soluble, 1 (LGALS1) |
CNY 1800.00 |
其它Galectin 1产品
