Galectin 1 (LGALS1) (NM_002305) Human Mass Spec Standard
CAT#: PH304674
LGALS1 MS Standard C13 and N15-labeled recombinant protein (NP_002296)
View other "Galectin 1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | LGALS1 MS Standard C13 and N15-labeled recombinant protein (NP_002296) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204674 |
Predicted MW | 14.7 kDa |
Protein Sequence |
>RC204674 protein sequence
Red=Cloning site Green=Tags(s) MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002296 |
RefSeq Size | 586 |
RefSeq ORF | 405 |
Synonyms | GAL1; GBP |
Locus ID | 3956 |
Cytogenetics | 22q13.1 |
Summary | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400833 | LGALS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400833 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 1 (LGALS1) |
CNY 3080.00 |
|
TP304674 | Recombinant protein of human lectin, galactoside-binding, soluble, 1 (LGALS1), 20 µg |
CNY 2900.00 |
|
TP720620 | Purified recombinant protein of Human lectin, galactoside-binding, soluble, 1 (LGALS1) |
CNY 1800.00 |
其它Galectin 1产品