CFHL2 (CFHR2) (NM_005666) Human Mass Spec Standard
CAT#: PH304689
CFHR2 MS Standard C13 and N15-labeled recombinant protein (NP_005657)
View other "CFHL2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CFHR2 MS Standard C13 and N15-labeled recombinant protein (NP_005657) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204689 |
| Predicted MW | 30.7 kDa |
| Protein Sequence |
>RC204689 protein sequence
Red=Cloning site Green=Tags(s) MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI TCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKC RSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVIS QEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005657 |
| RefSeq Size | 1043 |
| RefSeq ORF | 810 |
| Synonyms | CFHL2; FHR2; HFL3 |
| Locus ID | 3080 |
| Cytogenetics | 1q31.3 |
| Summary | This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401729 | CFHR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401729 | Transient overexpression lysate of complement factor H-related 2 (CFHR2) |
CNY 3080.00 |
|
| TP304689 | Purified recombinant protein of Homo sapiens complement factor H-related 2 (CFHR2), 20 µg |
CNY 2900.00 |
|
| TP720675 | Purified recombinant protein of Human complement factor H-related 2 (CFHR2) |
CNY 3140.00 |
