CH25H (NM_003956) Human Mass Spec Standard
CAT#: PH304716
CH25H MS Standard C13 and N15-labeled recombinant protein (NP_003947)
View other "CH25H" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CH25H MS Standard C13 and N15-labeled recombinant protein (NP_003947) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204716 |
| Predicted MW | 31.7 kDa |
| Protein Sequence |
>RC204716 protein sequence
Red=Cloning site Green=Tags(s) MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRR YKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFF VWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWL SVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003947 |
| RefSeq Size | 1378 |
| RefSeq ORF | 816 |
| Synonyms | C25H |
| Locus ID | 9023 |
| Cytogenetics | 10q23.31 |
| Summary | This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Protein Pathways | Primary bile acid biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418326 | CH25H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418326 | Transient overexpression lysate of cholesterol 25-hydroxylase (CH25H) |
CNY 3080.00 |
|
| TP304716 | Recombinant protein of human cholesterol 25-hydroxylase (CH25H), 20 µg |
CNY 2900.00 |
