SULT2A1 (NM_003167) Human Mass Spec Standard
CAT#: PH304737
SULT2A1 MS Standard C13 and N15-labeled recombinant protein (NP_003158)
View other "SULT2A1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SULT2A1 MS Standard C13 and N15-labeled recombinant protein (NP_003158) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204737 |
Predicted MW | 33.8 kDa |
Protein Sequence |
>RC204737 protein sequence
Red=Cloning site Green=Tags(s) MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVP IWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFI KKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEE LNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRE LFPWE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003158 |
RefSeq Size | 1987 |
RefSeq ORF | 855 |
Synonyms | DHEA-ST; DHEA-ST8; DHEAS; HST; hSTa; ST2; ST2A1; ST2A3; STD; SULT2A3 |
Locus ID | 6822 |
Cytogenetics | 19q13.33 |
Summary | This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome. [provided by RefSeq, Mar 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418856 | SULT2A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418856 | Transient overexpression lysate of sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 (SULT2A1) |
CNY 3080.00 |
|
TP304737 | Recombinant protein of human sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 (SULT2A1), 20 µg |
CNY 2900.00 |
|
TP720938 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 (SULT2A1) |
CNY 1800.00 |
其它SULT2A1产品