STK32A (NM_145001) Human Mass Spec Standard
CAT#: PH304769
STK32A MS Standard C13 and N15-labeled recombinant protein (NP_659438)
View other "STK32A" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | STK32A MS Standard C13 and N15-labeled recombinant protein (NP_659438) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204769 |
| Predicted MW | 19.8 kDa |
| Protein Sequence |
>RC204769 protein sequence
Red=Cloning site Green=Tags(s) MGANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFK ELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQ RIIHRDMKPDNILLDEHDTWLSYKSH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_659438 |
| RefSeq Size | 888 |
| RefSeq ORF | 498 |
| Synonyms | YANK1 |
| Locus ID | 202374 |
| Cytogenetics | 5q32 |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408139 | STK32A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426375 | STK32A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408139 | Transient overexpression lysate of serine/threonine kinase 32A (STK32A), transcript variant 2 |
CNY 3080.00 |
|
| LY426375 | Transient overexpression lysate of serine/threonine kinase 32A (STK32A), transcript variant 1 |
CNY 3080.00 |
|
| TP304769 | Recombinant protein of human serine/threonine kinase 32A (STK32A), transcript variant 2, 20 µg |
CNY 2900.00 |
