TIMM8A (NM_004085) Human Mass Spec Standard
CAT#: PH304771
TIMM8A MS Standard C13 and N15-labeled recombinant protein (NP_004076)
View other "TIMM8A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | TIMM8A MS Standard C13 and N15-labeled recombinant protein (NP_004076) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204771 |
Predicted MW | 11 kDa |
Protein Sequence |
>RC204771 protein sequence
Red=Cloning site Green=Tags(s) MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERF IDTSQFILNRLEQTQKSKPVFSESLSD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004076 |
RefSeq Size | 1459 |
RefSeq ORF | 291 |
Synonyms | DDP; DDP1; DFN1; MTS; TIM8 |
Locus ID | 1678 |
Cytogenetics | Xq22.1 |
Summary | This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70 kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418228 | TIMM8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418228 | Transient overexpression lysate of translocase of inner mitochondrial membrane 8 homolog A (yeast) (TIMM8A), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
TP304771 | Recombinant protein of human translocase of inner mitochondrial membrane 8 homolog A (yeast) (TIMM8A), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |