TAX1BP3 (NM_014604) Human Mass Spec Standard
CAT#: PH304776
TAX1BP3 MS Standard C13 and N15-labeled recombinant protein (NP_055419)
View other "TAX1BP3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TAX1BP3 MS Standard C13 and N15-labeled recombinant protein (NP_055419) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204776 |
Predicted MW | 13.7 kDa |
Protein Sequence |
>RC204776 protein sequence
Red=Cloning site Green=Tags(s) MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055419 |
RefSeq Size | 1398 |
RefSeq ORF | 372 |
Synonyms | TIP-1; TIP1 |
Locus ID | 30851 |
Cytogenetics | 17p13.2 |
Summary | This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter functions. The encoded protein interacts with a large number of target proteins that play roles in signaling pathways; for example, it interacts with Rho A and glutaminase L and also acts as a negative regulator of the Wnt/beta-catenin signaling pathway. This protein was first identified as binding to the T-cell leukaemia virus (HTLV1) Tax oncoprotein. Overexpression of this gene has been implicated in altered cancer cell adhesion, migration and metastasis. The encoded protein also modulates the localization and density of inwardly rectifying potassium channel 2.3 (Kir2.3). To date, this protein has been shown to play a role in cell proliferation, development, stress response, and polarization. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415159 | TAX1BP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415159 | Transient overexpression lysate of Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3) |
CNY 3080.00 |
|
TP304776 | Recombinant protein of human Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), 20 µg |
CNY 2900.00 |
其它TAX1BP3产品