Hex (HHEX) (NM_002729) Human Mass Spec Standard
CAT#: PH304815
HHEX MS Standard C13 and N15-labeled recombinant protein (NP_002720)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HHEX MS Standard C13 and N15-labeled recombinant protein (NP_002720) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204815 |
| Predicted MW | 29.8 kDa |
| Protein Sequence |
>RC204815 representing NM_002729
Red=Cloning site Green=Tags(s) MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVY EPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG QVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELES LDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002720 |
| RefSeq Size | 1772 |
| RefSeq ORF | 810 |
| Synonyms | HEX; HMPH; HOX11L-PEN; PRH; PRHX |
| Locus ID | 3087 |
| Cytogenetics | 10q23.33 |
| Summary | This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Maturity onset diabetes of the young |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419139 | HHEX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419139 | Transient overexpression lysate of hematopoietically expressed homeobox (HHEX) |
CNY 3080.00 |
|
| TP304815 | Recombinant protein of human hematopoietically expressed homeobox (HHEX), 20 µg |
CNY 2900.00 |
