RRAS (NM_006270) Human Mass Spec Standard
CAT#: PH304820
RRAS MS Standard C13 and N15-labeled recombinant protein (NP_006261)
View other "RRAS" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RRAS MS Standard C13 and N15-labeled recombinant protein (NP_006261) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204820 |
| Predicted MW | 23.5 kDa |
| Protein Sequence |
>RC204820 protein sequence
Red=Cloning site Green=Tags(s) MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG GGCPCVLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006261 |
| RefSeq Size | 1013 |
| RefSeq ORF | 654 |
| Synonyms | R-Ras |
| Locus ID | 6237 |
| Cytogenetics | 19q13.33 |
| Summary | The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. [provided by RefSeq, Jul 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416758 | RRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416758 | Transient overexpression lysate of related RAS viral (r-ras) oncogene homolog (RRAS) |
CNY 3080.00 |
|
| TP304820 | Recombinant protein of human related RAS viral (r-ras) oncogene homolog (RRAS), 20 µg |
CNY 2900.00 |
