NMNAT1 (NM_022787) Human Mass Spec Standard
CAT#: PH304825
NMNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_073624)
View other "NMNAT1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | NMNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_073624) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204825 |
Predicted MW | 31.9 kDa |
Protein Sequence |
>RC204825 protein sequence
Red=Cloning site Green=Tags(s) MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMA ELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKS LEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNI HVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_073624 |
RefSeq Size | 3781 |
RefSeq ORF | 837 |
Synonyms | LCA9; NMNAT; PNAT1; SHILCA |
Locus ID | 64802 |
Cytogenetics | 1p36.22 |
Summary | This gene encodes an enzyme which catalyzes a key step in the biosynthesis of nicotinamide adenine dinucleotide (NAD). The encoded enzyme is one of several nicotinamide nucleotide adenylyltransferases, and is specifically localized to the cell nucleus. Activity of this protein leads to the activation of a nuclear deacetylase that functions in the protection of damaged neurons. Mutations in this gene have been associated with Leber congenital amaurosis 9. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14, and 15. [provided by RefSeq, Jul 2014] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402948 | NMNAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402948 | Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 1 (NMNAT1) |
CNY 3080.00 |
|
TP304825 | Recombinant protein of human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), 20 µg |
CNY 2900.00 |