HINT3 (NM_138571) Human Mass Spec Standard
CAT#: PH304844
HINT3 MS Standard C13 and N15-labeled recombinant protein (NP_612638)
View other "HINT3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HINT3 MS Standard C13 and N15-labeled recombinant protein (NP_612638) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204844 |
| Predicted MW | 20.4 kDa |
| Protein Sequence |
>RC204844 protein sequence
Red=Cloning site Green=Tags(s) MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENED LICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCS ISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_612638 |
| RefSeq Size | 3396 |
| RefSeq ORF | 546 |
| Synonyms | HINT4 |
| Locus ID | 135114 |
| Cytogenetics | 6q22.32 |
| Summary | Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403361 | HINT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403361 | Transient overexpression lysate of histidine triad nucleotide binding protein 3 (HINT3) |
CNY 3080.00 |
|
| TP304844 | Recombinant protein of human histidine triad nucleotide binding protein 3 (HINT3), 20 µg |
CNY 2900.00 |
