MUM1 (IRF4) (NM_002460) Human Mass Spec Standard
CAT#: PH304876
IRF4 MS Standard C13 and N15-labeled recombinant protein (NP_002451)
View other "MUM1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | IRF4 MS Standard C13 and N15-labeled recombinant protein (NP_002451) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204876 |
Predicted MW | 51.8 kDa |
Protein Sequence |
>RC204876 protein sequence
Red=Cloning site Green=Tags(s) MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAAL FKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLT LEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPAC ENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGH TYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002451 |
RefSeq Size | 5332 |
RefSeq ORF | 1353 |
Synonyms | LSIRF; MUM1; NF-EM5; SHEP8 |
Locus ID | 3662 |
Cytogenetics | 6p25.3 |
Summary | The protein encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain. The IRFs are important in the regulation of interferons in response to infection by virus, and in the regulation of interferon-inducible genes. This family member is lymphocyte specific and negatively regulates Toll-like-receptor (TLR) signaling that is central to the activation of innate and adaptive immune systems. A chromosomal translocation involving this gene and the IgH locus, t(6;14)(p25;q32), may be a cause of multiple myeloma. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419304 | IRF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419304 | Transient overexpression lysate of interferon regulatory factor 4 (IRF4) |
CNY 3080.00 |
|
TP304876 | Recombinant protein of human interferon regulatory factor 4 (IRF4), 20 µg |
CNY 2900.00 |
|
TP761388 | Purified recombinant protein of Human interferon regulatory factor 4 (IRF4), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |