Solute carrier family 22 member 18 (SLC22A18) (NM_183233) Human Mass Spec Standard
CAT#: PH304889
SLC22A18 MS Standard C13 and N15-labeled recombinant protein (NP_899056)
View other "Solute carrier family 22 member 18" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SLC22A18 MS Standard C13 and N15-labeled recombinant protein (NP_899056) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204889 |
Predicted MW | 44.8 kDa |
Protein Sequence |
>RC204889 protein sequence
Red=Cloning site Green=Tags(s) MQGARAPRDQGQSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYLSRKLGLDSIAFGYLQTTFGV LQLLGGPVFGRFADQRGARAALTLSFLAALALYLLLAAASSPALPGVYLLFASRLPGALMHTLPAAQMVI TDLSAPEERPAALGRLGLCFGVGVILGSLLGGTLVSAYGIQCPAILAALATLLGAVLSFTCIPASTKGAK TDAQAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVASNCPTGLFMVMFSIISMDFFQLEAAQAGYLM SFFGLLQMVTQGLVIGQLSSHFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTD SMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQVAINTLVLLVLWRKPMPQRK DKVR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_899056 |
RefSeq Size | 1563 |
RefSeq ORF | 1272 |
Synonyms | BWR1A; BWSCR1A; HET; IMPT1; ITM; ORCTL2; p45-BWR1A; SLC22A1L; TSSC5 |
Locus ID | 5002 |
Cytogenetics | 11p15.4 |
Summary | This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is imprinted, with preferential expression from the maternal allele. Mutations in this gene have been found in Wilms' tumor and lung cancer. This protein may act as a transporter of organic cations, and have a role in the transport of chloroquine and quinidine-related compounds in kidney. Several alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403653 | SLC22A18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419259 | SLC22A18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY403653 | Transient overexpression lysate of solute carrier family 22, member 18 (SLC22A18), transcript variant 2 |
CNY 3080.00 |
|
LY419259 | Transient overexpression lysate of solute carrier family 22, member 18 (SLC22A18), transcript variant 1 |
CNY 4840.00 |
|
TP304889 | Recombinant protein of human solute carrier family 22, member 18 (SLC22A18), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Solute carrier family 22 member 18产品