ADH5 (NM_000671) Human Mass Spec Standard
CAT#: PH304903
ADH5 MS Standard C13 and N15-labeled recombinant protein (NP_000662)
View other "ADH5" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | ADH5 MS Standard C13 and N15-labeled recombinant protein (NP_000662) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC204903 | 
| Predicted MW | 39.7 kDa | 
| Protein Sequence | 
                 >RC204903 protein sequence 
Red=Cloning site Green=Tags(s) MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGA GIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHY MGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMG CKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALE ACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNL SFDEINKAFELMHSGKSIRTVVKI myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_000662 | 
| RefSeq Size | 2652 | 
| RefSeq ORF | 1122 | 
| Synonyms | ADH-3; ADHX; AMEDS; BMFS7; FALDH; FDH; GSH-FDH; GSNOR; HEL-S-60p | 
| Locus ID | 128 | 
| Cytogenetics | 4q23 | 
| Summary | This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene. [provided by RefSeq, Oct 2008] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Methane metabolism, Retinol metabolism, Tyrosine metabolism | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400220 | ADH5 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400220 | Transient overexpression lysate of alcohol dehydrogenase 5 (class III), chi polypeptide (ADH5) | 
                                                     CNY 3080.00  | 
                                            |
| TP304903 | Recombinant protein of human alcohol dehydrogenase 5 (class III), chi polypeptide (ADH5), 20 µg | 
                                                     CNY 2900.00  | 
                                            
