PECI (ECI2) (NM_006117) Human Mass Spec Standard
CAT#: PH304994
PECI MS Standard C13 and N15-labeled recombinant protein (NP_006108)
View other "PECI" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PECI MS Standard C13 and N15-labeled recombinant protein (NP_006108) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204994 |
| Predicted MW | 40.2 kDa |
| Protein Sequence |
>RC204994 protein sequence
Red=Cloning site Green=Tags(s) MNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALG SLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYH EIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIA VVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGE ACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDEC TNAVVNFLSRKSKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006108 |
| RefSeq Size | 1410 |
| RefSeq ORF | 1092 |
| Synonyms | ACBD2; dJ1013A10.3; DRS-1; DRS1; HCA88; PECI |
| Locus ID | 10455 |
| Cytogenetics | 6p25.2 |
| Summary | This gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising during the stepwise degradation of cis-, mono-, and polyunsaturated fatty acids to the 2-trans-enoyl-CoA intermediates. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011] |
| Protein Pathways | Fatty acid metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401844 | ECI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431874 | ECI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401844 | Transient overexpression lysate of peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1 |
CNY 3080.00 |
|
| LY431874 | Transient overexpression lysate of enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3 |
CNY 3080.00 |
|
| TP304994 | Recombinant protein of human peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP328846 | Recombinant protein of human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3, 20 µg |
CNY 2900.00 |
