PC4 (SUB1) (NM_006713) Human Mass Spec Standard
CAT#: PH304999
SUB1 MS Standard C13 and N15-labeled recombinant protein (NP_006704)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SUB1 MS Standard C13 and N15-labeled recombinant protein (NP_006704) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204999 |
Predicted MW | 14.4 kDa |
Protein Sequence |
>RC204999 protein sequence
Red=Cloning site Green=Tags(s) MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006704 |
RefSeq Size | 3522 |
RefSeq ORF | 381 |
Synonyms | p14; P15; PC4 |
Locus ID | 10923 |
Cytogenetics | 5p13.3 |
Summary | General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402009 | SUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402009 | Transient overexpression lysate of SUB1 homolog (S. cerevisiae) (SUB1) |
CNY 3080.00 |
|
TP304999 | Recombinant protein of human SUB1 homolog (S. cerevisiae) (SUB1), 20 µg |
CNY 2900.00 |