RDH11 (NM_016026) Human Mass Spec Standard
CAT#: PH305003
RDH11 MS Standard C13 and N15-labeled recombinant protein (NP_057110)
View other "RDH11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RDH11 MS Standard C13 and N15-labeled recombinant protein (NP_057110) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205003 |
| Predicted MW | 35.4 kDa |
| Protein Sequence |
>RC205003 protein sequence
Red=Cloning site Green=Tags(s) MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYL ACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTAD GFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANI LFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILS GNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLSID myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057110 |
| RefSeq Size | 2587 |
| RefSeq ORF | 954 |
| Synonyms | ARSDR1; CGI82; HCBP12; MDT1; PSDR1; RALR1; RDJCSS; SCALD; SDR7C1 |
| Locus ID | 51109 |
| Cytogenetics | 14q24.1 |
| Summary | The protein encoded by this gene is an NADPH-dependent retinal reductase and a short-chain dehydrogenase/reductase. The encoded protein has no steroid dehydrogenase activity. [provided by RefSeq, Nov 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Retinol metabolism |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Sample matrix has a major impact on accuracy of peptide quantification: Assessment of calibrator and internal standard selection and method validation
,Arnold, SL;Stevison, F;Isoherranen, N;,
Analytical chemistry
,PubMed ID 26606514
[RDH11]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402488 | RDH11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402488 | Transient overexpression lysate of retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11) |
CNY 3080.00 |
|
| TP305003 | Recombinant protein of human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 20 µg |
CNY 2900.00 |


