RABL3 (NM_173825) Human Mass Spec Standard
CAT#: PH305024
RABL3 MS Standard C13 and N15-labeled recombinant protein (NP_776186)
View other "RABL3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RABL3 MS Standard C13 and N15-labeled recombinant protein (NP_776186) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205024 |
| Predicted MW | 26.3 kDa |
| Protein Sequence |
>RC205024 protein sequence
Red=Cloning site Green=Tags(s) MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGS VGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQI PLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFL REGNQIPGFPDRKRFGAGTLKSLHYD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_776186 |
| RefSeq Size | 3883 |
| RefSeq ORF | 708 |
| Synonyms | PNCA5 |
| Locus ID | 285282 |
| Cytogenetics | 3q13.33 |
| Summary | Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function (By similarity). Not required for myeloid cell development (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406430 | RABL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406430 | Transient overexpression lysate of RAB, member of RAS oncogene family-like 3 (RABL3) |
CNY 3080.00 |
|
| TP305024 | Recombinant protein of human RAB, member of RAS oncogene family-like 3 (RABL3), 20 µg |
CNY 2900.00 |
