RAB2B (NM_032846) Human Mass Spec Standard
CAT#: PH305033
RAB2B MS Standard C13 and N15-labeled recombinant protein (NP_116235)
View other "RAB2B" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB2B MS Standard C13 and N15-labeled recombinant protein (NP_116235) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205033 |
| Predicted MW | 24.2 kDa |
| Protein Sequence |
>RC205033 protein sequence
Red=Cloning site Green=Tags(s) MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFARE HGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIG SNSGCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116235 |
| RefSeq Size | 2956 |
| RefSeq ORF | 648 |
| Locus ID | 84932 |
| Cytogenetics | 14q11.2 |
| Summary | Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508.[supplied by OMIM, Apr 2006] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409882 | RAB2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431135 | RAB2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409882 | Transient overexpression lysate of RAB2B, member RAS oncogene family (RAB2B), transcript variant 1 |
CNY 3080.00 |
|
| LY431135 | Transient overexpression lysate of RAB2B, member RAS oncogene family (RAB2B), transcript variant 2 |
CNY 3080.00 |
|
| TP305033 | Recombinant protein of human RAB2B, member RAS oncogene family (RAB2B), 20 µg |
CNY 2900.00 |
