H4-16 (NM_175054) Human Mass Spec Standard
CAT#: PH305064
HIST4H4 MS Standard C13 and N15-labeled recombinant protein (NP_778224)
View other "H4-16" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HIST4H4 MS Standard C13 and N15-labeled recombinant protein (NP_778224) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205064 |
| Predicted MW | 11.2 kDa |
| Protein Sequence |
>RC205064 representing NM_175054
Red=Cloning site Green=Tags(s) MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_778224 |
| RefSeq Size | 412 |
| RefSeq ORF | 309 |
| Synonyms | H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4 |
| Locus ID | 121504 |
| Cytogenetics | 12p12.3 |
| Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
| Protein Pathways | Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406378 | HIST4H4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406378 | Transient overexpression lysate of histone cluster 4, H4 (HIST4H4) |
CNY 3080.00 |
|
| TP305064 | Recombinant protein of human histone cluster 4, H4 (HIST4H4), 20 µg |
CNY 2900.00 |
