SH2D1B (NM_053282) Human Mass Spec Standard
CAT#: PH305069
SH2D1B MS Standard C13 and N15-labeled recombinant protein (NP_444512)
View other "SH2D1B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SH2D1B MS Standard C13 and N15-labeled recombinant protein (NP_444512) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205069 |
Predicted MW | 15.3 kDa |
Protein Sequence |
>RC205069 protein sequence
Red=Cloning site Green=Tags(s) MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_444512 |
RefSeq Size | 2553 |
RefSeq ORF | 396 |
Synonyms | EAT2 |
Locus ID | 117157 |
Cytogenetics | 1q23.3 |
Summary | By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409300 | SH2D1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409300 | Transient overexpression lysate of SH2 domain containing 1B (SH2D1B) |
CNY 3080.00 |
|
TP305069 | Recombinant protein of human SH2 domain containing 1B (SH2D1B), 20 µg |
CNY 2900.00 |