Lactate Dehydrogenase B (LDHB) (NM_002300) Human Mass Spec Standard
CAT#: PH305074
LDHB MS Standard C13 and N15-labeled recombinant protein (NP_002291)
View other "Lactate Dehydrogenase B" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LDHB MS Standard C13 and N15-labeled recombinant protein (NP_002291) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205074 |
| Predicted MW | 36.5 kDa |
| Protein Sequence |
>RC205074 representing NM_002300
Red=Cloning site Green=Tags(s) MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGS LFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNP VDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGV SLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKG MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002291 |
| RefSeq Size | 1336 |
| RefSeq ORF | 1002 |
| Synonyms | HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5 |
| Locus ID | 3945 |
| Cytogenetics | 12p12.1 |
| Summary | This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400836 | LDHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400836 | Transient overexpression lysate of lactate dehydrogenase B (LDHB) |
CNY 3080.00 |
|
| TP305074 | Recombinant protein of human lactate dehydrogenase B (LDHB), 20 µg |
CNY 2900.00 |
|
| TP720210 | Recombinant protein of human lactate dehydrogenase B (LDHB), transcript variant 2. |
CNY 1800.00 |
其它Lactate Dehydrogenase B产品
