Thymosin beta 10 (TMSB10) (NM_021103) Human Mass Spec Standard
CAT#: PH305097
TMSB10 MS Standard C13 and N15-labeled recombinant protein (NP_066926)
View other "Thymosin beta 10" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | TMSB10 MS Standard C13 and N15-labeled recombinant protein (NP_066926) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC205097 | 
| Predicted MW | 5 kDa | 
| Protein Sequence | 
                 >RC205097 protein sequence 
Red=Cloning site Green=Tags(s) MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_066926 | 
| RefSeq Size | 482 | 
| RefSeq ORF | 132 | 
| Synonyms | MIG12; TB10 | 
| Locus ID | 9168 | 
| Cytogenetics | 2p11.2 | 
| Summary | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402833 | TMSB10 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402833 | Transient overexpression lysate of thymosin beta 10 (TMSB10) | 
                                                     CNY 3080.00  | 
                                            |
| TP305097 | Recombinant protein of human thymosin beta 10 (TMSB10), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它Thymosin beta 10产品
