SHMT1 (NM_148918) Human Mass Spec Standard
CAT#: PH305102
SHMT1 MS Standard C13 and N15-labeled recombinant protein (NP_683718)
View other "SHMT1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SHMT1 MS Standard C13 and N15-labeled recombinant protein (NP_683718) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205102 |
| Predicted MW | 49 kDa |
| Protein Sequence |
>RC205102 protein sequence
Red=Cloning site Green=Tags(s) MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLN NKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMG LDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLE YARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVAVALKQA MTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTC PGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQA AVQALREEVESFASLFPLPGLPDF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_683718 |
| RefSeq Size | 2436 |
| RefSeq ORF | 1332 |
| Synonyms | CSHMT; SHMT |
| Locus ID | 6470 |
| Cytogenetics | 17p11.2 |
| Summary | This gene encodes the cytosolic form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one-carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. A pseudogene of this gene is located on the short arm of chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Pathways | Cyanoamino acid metabolism, Glycine, serine and threonine metabolism, Metabolic pathways, Methane metabolism, One carbon pool by folate |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401341 | SHMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407729 | SHMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401341 | Transient overexpression lysate of serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 1 |
CNY 3080.00 |
|
| LY407729 | Transient overexpression lysate of serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 2 |
CNY 3080.00 |
|
| PH303461 | SHMT1 MS Standard C13 and N15-labeled recombinant protein (NP_004160) |
CNY 19520.00 |
|
| TP303461 | Recombinant protein of human serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP305102 | Recombinant protein of human serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 2, 20 µg |
CNY 2900.00 |
