C4orf3 (NM_001001701) Human Mass Spec Standard
CAT#: PH305103
C4orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001001701)
View other "C4orf3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | C4orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001001701) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205103 |
Predicted MW | 7.6 kDa |
Protein Sequence |
>RC205103 protein sequence
Red=Cloning site Green=Tags(s) MEVDAPGVDGRDGLREQRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001001701 |
RefSeq Size | 2854 |
RefSeq ORF | 198 |
Synonyms | ALN; HCVFTP1 |
Locus ID | 401152 |
Cytogenetics | 4q26 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424211 | C4orf3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424211 | Transient overexpression lysate of chromosome 4 open reading frame 3 (C4orf3), transcript variant 2 |
CNY 3080.00 |
|
TP305103 | Purified recombinant protein of Homo sapiens chromosome 4 open reading frame 3 (C4orf3), 20 µg |
CNY 2900.00 |