PHF7 (NM_016483) Human Mass Spec Standard
CAT#: PH305192
PHF7 MS Standard C13 and N15-labeled recombinant protein (NP_057567)
View other "PHF7" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PHF7 MS Standard C13 and N15-labeled recombinant protein (NP_057567) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205192 |
| Predicted MW | 43.8 kDa |
| Protein Sequence |
>RC205192 protein sequence
Red=Cloning site Green=Tags(s) MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQ RGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSF CDKHRPTQNIQHGHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNR KEFPQEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHG THRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPS LLEKPESSRGRRSYSWRSKGVRITNSCKKSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057567 |
| RefSeq Size | 2240 |
| RefSeq ORF | 1143 |
| Synonyms | HSPC045; HSPC226; NYD-SP6 |
| Locus ID | 51533 |
| Cytogenetics | 3p21.1 |
| Summary | Spermatogenesis is a complex process regulated by extracellular and intracellular factors as well as cellular interactions among interstitial cells of the testis, Sertoli cells, and germ cells. This gene is expressed in the testis in Sertoli cells but not germ cells. The protein encoded by this gene contains plant homeodomain (PHD) finger domains, also known as leukemia associated protein (LAP) domains, believed to be involved in transcriptional regulation. The protein, which localizes to the nucleus of transfected cells, has been implicated in the transcriptional regulation of spermatogenesis. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402558 | PHF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406629 | PHF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402558 | Transient overexpression lysate of PHD finger protein 7 (PHF7), transcript variant 1 |
CNY 3080.00 |
|
| LY406629 | Transient overexpression lysate of PHD finger protein 7 (PHF7), transcript variant 2 |
CNY 3080.00 |
|
| TP305192 | Recombinant protein of human PHD finger protein 7 (PHF7), transcript variant 1, 20 µg |
CNY 2900.00 |
