PTS (NM_000317) Human Mass Spec Standard
CAT#: PH305199
PTS MS Standard C13 and N15-labeled recombinant protein (NP_000308)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PTS MS Standard C13 and N15-labeled recombinant protein (NP_000308) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205199 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC205199 protein sequence
Red=Cloning site Green=Tags(s) MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMV MNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYMWDNLQKVLPVGVLYKVKVYETDNNIV VYKGE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000308 |
RefSeq Size | 948 |
RefSeq ORF | 435 |
Synonyms | PTPS |
Locus ID | 5805 |
Cytogenetics | 11q23.1 |
Summary | The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400120 | PTS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400120 | Transient overexpression lysate of 6-pyruvoyltetrahydropterin synthase (PTS) |
CNY 3080.00 |
|
TP305199 | Recombinant protein of human 6-pyruvoyltetrahydropterin synthase (PTS), 20 µg |
CNY 2900.00 |