INSIG2 (NM_016133) Human Mass Spec Standard
CAT#: PH305274
INSIG2 MS Standard C13 and N15-labeled recombinant protein (NP_057217)
View other "INSIG2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | INSIG2 MS Standard C13 and N15-labeled recombinant protein (NP_057217) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205274 |
| Predicted MW | 24.8 kDa |
| Protein Sequence |
>RC205274 protein sequence
Red=Cloning site Green=Tags(s) MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSA WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAAL SIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQL AMYECKVIAEKSHQE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057217 |
| RefSeq Size | 2592 |
| RefSeq ORF | 675 |
| Synonyms | INSIG-2 |
| Locus ID | 51141 |
| Cytogenetics | 2q14.1-q14.2 |
| Summary | The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402504 | INSIG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402504 | Transient overexpression lysate of insulin induced gene 2 (INSIG2) |
CNY 3080.00 |
|
| TP305274 | Recombinant protein of human insulin induced gene 2 (INSIG2), 20 µg |
CNY 2900.00 |
