GNPTG (NM_032520) Human Mass Spec Standard
CAT#: PH305280
GNPTG MS Standard C13 and N15-labeled recombinant protein (NP_115909)
View other "GNPTG" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | GNPTG MS Standard C13 and N15-labeled recombinant protein (NP_115909) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205280 |
| Predicted MW | 33.8 kDa |
| Protein Sequence |
>RC205280 representing NM_032520
Red=Cloning site Green=Tags(s) MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGK CFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVEL ACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLR TLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEH LGHETPRAKSPEQLRGDPGLRGSL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115909 |
| RefSeq Size | 1228 |
| RefSeq ORF | 912 |
| Synonyms | C16orf27; GNPTAG; LP2537; RJD9 |
| Locus ID | 84572 |
| Cytogenetics | 16p13.3 |
| Summary | This gene encodes the gamma sunbunit of the N-acetylglucosamine-1-phosphotransferase complex. This hexameric complex, composed of alpha, beta and gamma subunits, catalyzes the first step in synthesis of a mannose 6-phosphate lysosomal recognition marker. This enzyme complex is necessary for targeting of lysosomal hydrolases to the lysosome. Mutations in the gene encoding the gamma subunit have been associated with mucolipidosis IIIC, also known as mucolipidosis III gamma.[provided by RefSeq, Feb 2010] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403165 | GNPTG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403165 | Transient overexpression lysate of N-acetylglucosamine-1-phosphate transferase, gamma subunit (GNPTG) |
CNY 3080.00 |
|
| TP305280 | Recombinant protein of human N-acetylglucosamine-1-phosphate transferase, gamma subunit (GNPTG), 20 µg |
CNY 2900.00 |
