GNG4 (NM_004485) Human Mass Spec Standard
CAT#: PH305299
GNG4 MS Standard C13 and N15-labeled recombinant protein (NP_004476)
View other "GNG4" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GNG4 MS Standard C13 and N15-labeled recombinant protein (NP_004476) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205299 |
Predicted MW | 8.4 kDa |
Protein Sequence |
>RC205299 protein sequence
Red=Cloning site Green=Tags(s) MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF FCTIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004476 |
RefSeq Size | 4885 |
RefSeq ORF | 225 |
Locus ID | 2786 |
Cytogenetics | 1q42.3 |
Summary | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417963 | GNG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420667 | GNG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420668 | GNG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417963 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 3 |
CNY 3080.00 |
|
LY420667 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 2 |
CNY 3080.00 |
|
LY420668 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 1 |
CNY 3080.00 |
|
TP305299 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 4 (GNG4), transcript variant 3, 20 µg |
CNY 2900.00 |