VILIP1 (VSNL1) (NM_003385) Human Mass Spec Standard
CAT#: PH305337
VSNL1 MS Standard C13 and N15-labeled recombinant protein (NP_003376)
View other "VILIP1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | VSNL1 MS Standard C13 and N15-labeled recombinant protein (NP_003376) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205337 |
| Predicted MW | 22.1 kDa |
| Protein Sequence |
>RC205337 protein sequence
Red=Cloning site Green=Tags(s) MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003376 |
| RefSeq Size | 2014 |
| RefSeq ORF | 573 |
| Synonyms | HLP3; HPCAL3; HUVISL1; VILIP; VILIP-1 |
| Locus ID | 7447 |
| Cytogenetics | 2p24.2 |
| Summary | This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418720 | VSNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418720 | Transient overexpression lysate of visinin-like 1 (VSNL1) |
CNY 3080.00 |
|
| TP305337 | Recombinant protein of human visinin-like 1 (VSNL1), 20 µg |
CNY 2900.00 |
|
| TP720237 | Recombinant protein of human visinin-like 1 (VSNL1) |
CNY 3140.00 |

