ALDH1A2 (NM_170696) Human Mass Spec Standard
CAT#: PH305342
ALDH1A2 MS Standard C13 and N15-labeled recombinant protein (NP_733797)
View other "ALDH1A2" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ALDH1A2 MS Standard C13 and N15-labeled recombinant protein (NP_733797) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205342 |
Predicted MW | 53.1 kDa |
Protein Sequence |
>RC205342 protein sequence
Red=Cloning site Green=Tags(s) MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQ EADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDL QGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIK PAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQ CCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG GKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKAL TVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_733797 |
RefSeq Size | 3492 |
RefSeq ORF | 1440 |
Synonyms | RALDH(II); RALDH2; RALDH2-T |
Locus ID | 8854 |
Cytogenetics | 15q21.3 |
Summary | This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403525 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406883 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC418372 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC430305 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403525 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 2 |
CNY 3080.00 |
|
LY406883 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 3 |
CNY 4840.00 |
|
LY418372 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1 |
CNY 4840.00 |
|
PH323250 | ALDH1A2 MS Standard C13 and N15-labeled recombinant protein (NP_003879) |
CNY 19520.00 |
|
TP305342 | Recombinant protein of human aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP323250 | Recombinant protein of human aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它ALDH1A2产品