PPP3R2 (NM_147180) Human Mass Spec Standard
CAT#: PH305406
PPP3R2 MS Standard C13 and N15-labeled recombinant protein (NP_671709)
View other "PPP3R2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PPP3R2 MS Standard C13 and N15-labeled recombinant protein (NP_671709) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205406 |
| Predicted MW | 19.9 kDa |
| Protein Sequence |
>RC205406 protein sequence
Red=Cloning site Green=Tags(s) MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGD GEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTI IILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_671709 |
| RefSeq Size | 3401 |
| RefSeq ORF | 519 |
| Synonyms | PPP3RL |
| Locus ID | 5535 |
| Cytogenetics | 9q31.1 |
| Summary | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Phosphatase |
| Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407775 | PPP3R2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407775 | Transient overexpression lysate of protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform (PPP3R2) |
CNY 3080.00 |
|
| TP305406 | Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform (PPP3R2), 20 µg |
CNY 2900.00 |
