DYDC1 (NM_138812) Human Mass Spec Standard
CAT#: PH305409
DYDC1 MS Standard C13 and N15-labeled recombinant protein (NP_620167)
View other "DYDC1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DYDC1 MS Standard C13 and N15-labeled recombinant protein (NP_620167) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205409 |
| Predicted MW | 20.9 kDa |
| Protein Sequence |
>RC205409 protein sequence
Red=Cloning site Green=Tags(s) MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEM MERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSG KTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620167 |
| RefSeq Size | 787 |
| RefSeq ORF | 531 |
| Synonyms | DPY30D1 |
| Locus ID | 143241 |
| Cytogenetics | 10q23.1 |
| Summary | This gene encodes a member of a family of proteins that contains a DPY30 domain. The encoded protein is involved in acrosome formation during spermatid development. This gene locus overlaps with a closely related gene on the opposite strand. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408497 | DYDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408497 | Transient overexpression lysate of DPY30 domain containing 1 (DYDC1) |
CNY 3080.00 |
|
| TP305409 | Recombinant protein of human DPY30 domain containing 1 (DYDC1), 20 µg |
CNY 2900.00 |
