SYNPR (NM_144642) Human Mass Spec Standard
CAT#: PH305424
SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243)
View other "SYNPR" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205424 |
| Predicted MW | 29.2 kDa |
| Protein Sequence |
>RC205424 protein sequence
Red=Cloning site Green=Tags(s) MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLA LIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLS DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRY LSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_653243 |
| RefSeq Size | 2632 |
| RefSeq ORF | 795 |
| Synonyms | SPO |
| Locus ID | 132204 |
| Cytogenetics | 3p14.2 |
| Summary | Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403401 | SYNPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427094 | SYNPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403401 | Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 2 |
CNY 3080.00 |
|
| LY427094 | Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 1 |
CNY 3080.00 |
|
| PH325395 | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475) |
CNY 14250.00 |
|
| TP305424 | Recombinant protein of human synaptoporin (SYNPR), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP325395 | Purified recombinant protein of Homo sapiens synaptoporin (SYNPR), transcript variant 1, 20 µg |
CNY 2900.00 |
