AJUBA (NM_032876) Human Mass Spec Standard
CAT#: PH305482
JUB MS Standard C13 and N15-labeled recombinant protein (NP_116265)
View other "AJUBA" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | JUB MS Standard C13 and N15-labeled recombinant protein (NP_116265) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205482 |
Predicted MW | 56.9 kDa |
Protein Sequence |
>RC205482 protein sequence
Red=Cloning site Green=Tags(s) MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEPLEPAREQGSL DAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSPRSSFASSSASDASKPSSPRG SLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAGPCLFGPPLAGAPAGYSPGGVPSAYPELHAA LDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDEL TALLRLTVGTGGREAGARGEPSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSN ACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYH FECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116265 |
RefSeq Size | 4262 |
RefSeq ORF | 1614 |
Synonyms | JUB |
Locus ID | 84962 |
Cytogenetics | 14q11.2 |
Summary | Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, mitosis, cell-cell adhesion, cell differentiation, proliferation and migration. Contributes to the linking and/or strengthening of epithelia cell-cell junctions in part by linking adhesive receptors to the actin cytoskeleton. May be involved in signal transduction from cell adhesion sites to the nucleus. Plays an important role in regulation of the kinase activity of AURKA for mitotic commitment. Also a component of the IL-1 signaling pathway modulating IL-1-induced NFKB1 activation by influencing the assembly and activity of the PRKCZ-SQSTM1-TRAF6 multiprotein signaling complex. Functions as an HDAC-dependent corepressor for a subset of GFI1 target genes. Acts as a transcriptional corepressor for SNAI1 and SNAI2/SLUG-dependent repression of E-cadherin transcription. Acts as a hypoxic regulator by bridging an association between the prolyl hydroxylases and VHL enabling efficient degradation of HIF1A. Positively regulates microRNA (miRNA)-mediated gene silencing. Negatively regulates the Hippo signaling pathway and antagonizes phosphorylation of YAP1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405073 | AJUBA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409908 | AJUBA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405073 | Transient overexpression lysate of jub, ajuba homolog (Xenopus laevis) (JUB), transcript variant 2 |
CNY 3080.00 |
|
LY409908 | Transient overexpression lysate of jub, ajuba homolog (Xenopus laevis) (JUB), transcript variant 1 |
CNY 3080.00 |
|
TP305482 | Recombinant protein of human jub, ajuba homolog (Xenopus laevis) (JUB), transcript variant 1, 20 µg |
CNY 2900.00 |