LASS3 (CERS3) (NM_178842) Human Mass Spec Standard
CAT#: PH305511
LASS3 MS Standard C13 and N15-labeled recombinant protein (NP_849164)
View other "LASS3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LASS3 MS Standard C13 and N15-labeled recombinant protein (NP_849164) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205511 |
| Predicted MW | 46.2 kDa |
| Protein Sequence |
>RC205511 protein sequence
Red=Cloning site Green=Tags(s) MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFVASPLAKSFGI KETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSRRNQERPSRLKKFQEACWRFA FYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYWYYILEMSFYWSLLFRLGFDVKRKDFLAHII HHLAAISLMSFSWCANYIRSGTLVMIVHDVADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFP FWILYCTLILPMYHLEPFFSYIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEE EEEEEATKGKEMDCLKNGLGAERHLIPNGQHGH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_849164 |
| RefSeq Size | 3894 |
| RefSeq ORF | 1149 |
| Synonyms | ARCI9; LASS3 |
| Locus ID | 204219 |
| Cytogenetics | 15q26.3 |
| Summary | This gene is a member of the ceramide synthase family of genes. The ceramide synthase enzymes regulate sphingolipid synthesis by catalyzing the formation of ceramides from sphingoid base and acyl-coA substrates. This family member is involved in the synthesis of ceramides with ultra-long-chain acyl moieties (ULC-Cers), important to the epidermis in its role in creating a protective barrier from the environment. The protein encoded by this gene has also been implicated in modification of the lipid structures required for spermatogenesis. Mutations in this gene have been associated with male fertility defects, and epidermal defects, including ichthyosis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015] |
| Protein Families | Transcription Factors, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405858 | CERS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405858 | Transient overexpression lysate of LAG1 homolog, ceramide synthase 3 (LASS3) |
CNY 3080.00 |
|
| TP305511 | Recombinant protein of human LAG1 homolog, ceramide synthase 3 (LASS3), 20 µg |
CNY 2900.00 |
