C6orf57 (SDHAF4) (NM_145267) Human Mass Spec Standard
CAT#: PH305542
C6orf57 MS Standard C13 and N15-labeled recombinant protein (NP_660310)
View other "C6orf57" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C6orf57 MS Standard C13 and N15-labeled recombinant protein (NP_660310) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205542 |
Predicted MW | 12.2 kDa |
Protein Sequence |
>RC205542 protein sequence
Red=Cloning site Green=Tags(s) MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPMLPEGRFDAPEDSHLEKEP LEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660310 |
RefSeq Size | 526 |
RefSeq ORF | 324 |
Synonyms | C6orf57; Sdh8 |
Locus ID | 135154 |
Cytogenetics | 6q13 |
Summary | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol (PubMed:24954416). Binds to the flavoprotein subunit SDHA in its FAD-bound form, blocking the generation of excess reactive oxigen species (ROS) and facilitating its assembly with the iron-sulfur protein subunit SDHB into the SDH catalytic dimer (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407992 | SDHAF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407992 | Transient overexpression lysate of chromosome 6 open reading frame 57 (C6orf57) |
CNY 3080.00 |
|
TP305542 | Recombinant protein of human chromosome 6 open reading frame 57 (C6orf57), 20 µg |
CNY 2900.00 |
其它C6orf57产品