SERPINB4 (NM_002974) Human Mass Spec Standard
CAT#: PH305612
SERPINB4 MS Standard C13 and N15-labeled recombinant protein (NP_002965)
View other "SERPINB4" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SERPINB4 MS Standard C13 and N15-labeled recombinant protein (NP_002965) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205612 |
| Predicted MW | 44.9 kDa |
| Protein Sequence |
>RC205612 protein sequence
Red=Cloning site Green=Tags(s) MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKA ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAP EESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV QMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCV DLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVV VVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002965 |
| RefSeq Size | 1787 |
| RefSeq ORF | 1170 |
| Synonyms | LEUPIN; PI11; SCCA-2; SCCA1; SCCA2 |
| Locus ID | 6318 |
| Cytogenetics | 18q21.33 |
| Summary | The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation. [provided by RefSeq, Jan 2017] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418979 | SERPINB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418979 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4) |
CNY 3080.00 |
|
| TP305612 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4), 20 µg |
CNY 2900.00 |
|
| TP790064 | Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4), with N-terminal HIS tag, expressed in HEK293, 50ug |
CNY 3900.00 |
其它SERPINB4产品
