UBE2D1 (NM_003338) Human Mass Spec Standard
CAT#: PH305621
UBE2D1 MS Standard C13 and N15-labeled recombinant protein (NP_003329)
View other "UBE2D1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | UBE2D1 MS Standard C13 and N15-labeled recombinant protein (NP_003329) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205621 |
| Predicted MW | 16.4 kDa |
| Protein Sequence |
>RC205621 representing NM_003338
Red=Cloning site Green=Tags(s) MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE WTQKYAM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003329 |
| RefSeq Size | 2669 |
| RefSeq ORF | 441 |
| Synonyms | E2(17)KB1; SFT; UBC4/5; UBCH5; UBCH5A |
| Locus ID | 7321 |
| Cytogenetics | 10q21.1 |
| Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418756 | UBE2D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418756 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (UBE2D1) |
CNY 3080.00 |
|
| TP305621 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (UBE2D1), 20 µg |
CNY 2900.00 |
|
| TP721188 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2D 1 (UBE2D1), transcript variant 1 |
CNY 1800.00 |
