TMEM59 (NM_004872) Human Mass Spec Standard
CAT#: PH305624
TMEM59 MS Standard C13 and N15-labeled recombinant protein (NP_004863)
View other "TMEM59" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TMEM59 MS Standard C13 and N15-labeled recombinant protein (NP_004863) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205624 |
| Predicted MW | 36.3 kDa |
| Protein Sequence |
>RC205624 protein sequence
Red=Cloning site Green=Tags(s) MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYAC QRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHL LFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSSD LQMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGD LEFMNEQKLNRYPASSLVVVRSKTEDHEEAGPLPTKVNLAHSEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004863 |
| RefSeq Size | 1709 |
| RefSeq ORF | 972 |
| Synonyms | C1orf8; DCF1; HSPC001; PRO195; UNQ169 |
| Locus ID | 9528 |
| Cytogenetics | 1p32.3 |
| Summary | This gene encodes a protein shown to regulate autophagy in response to bacterial infection. This protein may also regulate the retention of amyloid precursor protein (APP) in the Golgi apparatus through its control of APP glycosylation. Overexpression of this protein has been found to promote apoptosis in a glioma cell line. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417690 | TMEM59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417690 | Transient overexpression lysate of transmembrane protein 59 (TMEM59) |
CNY 3080.00 |
|
| TP305624 | Recombinant protein of human transmembrane protein 59 (TMEM59), 20 µg |
CNY 2900.00 |

