SIRT7 (NM_016538) Human Mass Spec Standard
CAT#: PH305658
SIRT7 MS Standard C13 and N15-labeled recombinant protein (NP_057622)
View other "SIRT7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SIRT7 MS Standard C13 and N15-labeled recombinant protein (NP_057622) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205658 |
| Predicted MW | 44.9 kDa |
| Protein Sequence |
>RC205658 protein sequence
Red=Cloning site Green=Tags(s) MAAGGLSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESADLVTELQGRSRRREG LKRRQEEVCDDPEELRGKVRELASAVRNAKYLVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADL SEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVCTSCVPNREYVRVFDV TERTALHRHQTGRTCHKCGTQLRDTIVHFGERGTLGQPLNWEAATEAASRADTILCLGSSLKVLKKYPRL WCMTKPPSRRPKLYIVNLQWTPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAG EEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057622 |
| RefSeq Size | 1749 |
| RefSeq ORF | 1200 |
| Synonyms | SIR2L7 |
| Locus ID | 51547 |
| Cytogenetics | 17q25.3 |
| Summary | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402562 | SIRT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402562 | Transient overexpression lysate of sirtuin (silent mating type information regulation 2 homolog) 7 (S. cerevisiae) (SIRT7) |
CNY 3080.00 |
|
| TP305658 | Recombinant protein of human sirtuin (silent mating type information regulation 2 homolog) 7 (S. cerevisiae) (SIRT7), 20 µg |
CNY 2900.00 |
