FLVCR2 (NM_017791) Human Mass Spec Standard
CAT#: PH305665
FLVCR2 MS Standard C13 and N15-labeled recombinant protein (NP_060261)
View other "FLVCR2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FLVCR2 MS Standard C13 and N15-labeled recombinant protein (NP_060261) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205665 |
| Predicted MW | 57.2 kDa |
| Protein Sequence |
>RC205665 protein sequence
Red=Cloning site Green=Tags(s) MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSS GPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLP VAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIASVWFGANE VSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPP SRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIG LTIVIAGMLGAVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLGAALTAFIKAD LRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060261 |
| RefSeq Size | 3669 |
| RefSeq ORF | 1578 |
| Synonyms | C14orf58; CCT; EPV; FLVCRL14q; MFSD7C; PVHH; SLC49A2 |
| Locus ID | 55640 |
| Cytogenetics | 14q24.3 |
| Summary | This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Aug 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413533 | FLVCR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434160 | FLVCR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413533 | Transient overexpression lysate of feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2) |
CNY 3080.00 |
|
| LY434160 | Transient overexpression lysate of feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2), transcript variant 2 |
CNY 3080.00 |
|
| TP305665 | Recombinant protein of human feline leukemia virus subgroup C cellular receptor family, member 2 (FLVCR2), 20 µg |
CNY 2900.00 |
