NTAN1 (NM_173474) Human Mass Spec Standard
CAT#: PH305697
NTAN1 MS Standard C13 and N15-labeled recombinant protein (NP_775745)
View other "NTAN1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NTAN1 MS Standard C13 and N15-labeled recombinant protein (NP_775745) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205697 |
Predicted MW | 34.7 kDa |
Protein Sequence |
>RC205697 protein sequence
Red=Cloning site Green=Tags(s) MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSD DATTCHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLT HQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLA GGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPS PAHTLFSGNKALLYKKNEDGLWEKISSPGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_775745 |
RefSeq Size | 1241 |
RefSeq ORF | 930 |
Synonyms | PNAA; PNAD |
Locus ID | 123803 |
Cytogenetics | 16p13.11 |
Summary | The protein encoded by this gene functions in a step-wise process of protein degradation through the N-end rule pathway. This protein acts as a tertiary destabilizing enzyme that deamidates N-terminal L-Asn residues on proteins to produce N-terminal L-Asp. L-Asp substrates are subsequently conjugated to L-Arg, which is recognized by specific E3 ubiquitin ligases and targeted to the proteasome. Pseudogenes of this gene are located on the long arms of chromosomes 8, 10 and 12. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406607 | NTAN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406607 | Transient overexpression lysate of N-terminal asparagine amidase (NTAN1) |
CNY 3080.00 |
|
TP305697 | Recombinant protein of human N-terminal asparagine amidase (NTAN1), 20 µg |
CNY 2900.00 |