KCTD11 (NM_001002914) Human Mass Spec Standard
CAT#: PH305782
KCTD11 MS Standard C13 and N15-labeled recombinant protein (NP_001002914)
View other "KCTD11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | KCTD11 MS Standard C13 and N15-labeled recombinant protein (NP_001002914) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205782 |
| Predicted MW | 25.9 kDa |
| Protein Sequence |
>RC205782 protein sequence
Red=Cloning site Green=Tags(s) MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLL DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRAR FGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFR LDSVFPDPEDLLNSRSLRFVRH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001002914 |
| RefSeq Size | 3081 |
| RefSeq ORF | 696 |
| Synonyms | C17orf36; KCASH1; REN; REN/KCTD11 |
| Locus ID | 147040 |
| Cytogenetics | 17p13.1 |
| Summary | Plays a role as a marker and a regulator of neuronal differentiation; Up-regulated by a variety of neurogenic signals, such as retinoic acid, epidermal growth factor/EGF and NGFB/nerve growth factor. Induces apoptosis, growth arrest and the expression of cyclin-dependent kinase inhibitor CDKN1B. Plays a role as a tumor repressor and inhibits cell growth and tumorigenicity of medulloblastoma (MDB). Acts as probable substrate-specific adapter for a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex towards HDAC1. Functions as antagonist of the Hedgehog pathway on cell proliferation and differentiation by affecting the nuclear transfer of transcription factor GLI1, thus maintaining cerebellar granule cells in undifferentiated state, this effect probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. When knock-down, Hedgehog antagonism is impaired and proliferation of granule cells is sustained. Activates the caspase cascade.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424110 | KCTD11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424110 | Transient overexpression lysate of potassium channel tetramerisation domain containing 11 (KCTD11) |
CNY 3080.00 |
|
| TP305782 | Recombinant protein of human potassium channel tetramerisation domain containing 11 (KCTD11), 20 µg |
CNY 2900.00 |
