CALML3 (NM_005185) Human Mass Spec Standard
CAT#: PH305791
CALML3 MS Standard C13 and N15-labeled recombinant protein (NP_005176)
View other "CALML3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CALML3 MS Standard C13 and N15-labeled recombinant protein (NP_005176) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205791 |
| Predicted MW | 16.9 kDa |
| Protein Sequence |
>RC205791 protein sequence
Red=Cloning site Green=Tags(s) MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFL GMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYE EFVRVLVSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005176 |
| RefSeq Size | 1417 |
| RefSeq ORF | 447 |
| Synonyms | CLP |
| Locus ID | 810 |
| Cytogenetics | 10p15.1 |
| Summary | May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Alzheimer's disease, Calcium signaling pathway, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Phosphatidylinositol signaling system, Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417458 | CALML3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417458 | Transient overexpression lysate of calmodulin-like 3 (CALML3) |
CNY 3080.00 |
|
| TP305791 | Recombinant protein of human calmodulin-like 3 (CALML3), 20 µg |
CNY 2900.00 |
