hCG beta (CGB5) (NM_033043) Human Mass Spec Standard
CAT#: PH305928
CGB5 MS Standard C13 and N15-labeled recombinant protein (NP_149032)
View other "hCG beta" proteins (1)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CGB5 MS Standard C13 and N15-labeled recombinant protein (NP_149032) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205928 |
| Predicted MW | 17.7 kDa |
| Protein Sequence |
>RC205928 protein sequence
Red=Cloning site Green=Tags(s) MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLP ALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS SKAPPPSLPSPSRLPGPSDTPILPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_149032 |
| RefSeq Size | 880 |
| RefSeq ORF | 495 |
| Synonyms | CGB; HCG; hCGB |
| Locus ID | 93659 |
| Cytogenetics | 19q13.33 |
| Summary | This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 5 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP305928 | Purified recombinant protein of Homo sapiens chorionic gonadotropin, beta polypeptide 5 (CGB5), 20 µg |
CNY 2900.00 |
其它hCG beta产品
