Myosin Light Chain 2 (MYL2) (NM_000432) Human Mass Spec Standard
CAT#: PH305932
MYL2 MS Standard C13 and N15-labeled recombinant protein (NP_000423)
View other "Myosin Light Chain 2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MYL2 MS Standard C13 and N15-labeled recombinant protein (NP_000423) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205932 |
| Predicted MW | 18.8 kDa |
| Protein Sequence |
>RC205932 protein sequence
Red=Cloning site Green=Tags(s) MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000423 |
| RefSeq Size | 855 |
| RefSeq ORF | 498 |
| Synonyms | CMH10; MLC-2s/v; MLC2 |
| Locus ID | 4633 |
| Cytogenetics | 12q24.11 |
| Summary | Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400153 | MYL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400153 | Transient overexpression lysate of myosin, light chain 2, regulatory, cardiac, slow (MYL2) |
CNY 3080.00 |
|
| TP305932 | Recombinant protein of human myosin, light chain 2, regulatory, cardiac, slow (MYL2), 20 µg |
CNY 2900.00 |
其它Myosin Light Chain 2产品
