CRIP2 (NM_001312) Human Mass Spec Standard
CAT#: PH305938
CRIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001303)
View other "CRIP2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CRIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001303) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205938 |
| Predicted MW | 22.5 kDa |
| Protein Sequence |
>RC205938 protein sequence
Red=Cloning site Green=Tags(s) MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVT SLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001303 |
| RefSeq Size | 1247 |
| RefSeq ORF | 624 |
| Synonyms | CRIP; CRP2; ESP1 |
| Locus ID | 1397 |
| Cytogenetics | 14q32.33 |
| Summary | This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420019 | CRIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420019 | Transient overexpression lysate of cysteine-rich protein 2 (CRIP2) |
CNY 3080.00 |
|
| TP305938 | Recombinant protein of human cysteine-rich protein 2 (CRIP2), 20 µg |
CNY 2900.00 |
