PIP4K2C (NM_024779) Human Mass Spec Standard
CAT#: PH305976
PIP4K2C MS Standard C13 and N15-labeled recombinant protein (NP_079055)
View other "PIP4K2C" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PIP4K2C MS Standard C13 and N15-labeled recombinant protein (NP_079055) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205976 |
| Predicted MW | 47.3 kDa |
| Protein Sequence |
>RC205976 protein sequence
Red=Cloning site Green=Tags(s) MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR LPVHRKYDLKGSLVSREASDKEKVKELPTLRDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF A myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079055 |
| RefSeq Size | 3229 |
| RefSeq ORF | 1263 |
| Synonyms | PIP5K2C |
| Locus ID | 79837 |
| Cytogenetics | 12q13.3 |
| Summary | May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411069 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431328 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431351 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431365 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411069 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 1 |
CNY 3080.00 |
|
| LY431328 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 4 |
CNY 3080.00 |
|
| LY431351 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 3 |
CNY 3080.00 |
|
| LY431365 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2 |
CNY 3080.00 |
|
| TP305976 | Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), 20 µg |
CNY 2900.00 |
|
| TP328337 | Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2, 20 µg |
CNY 2900.00 |
其它PIP4K2C产品
